Edit |   |
Antigenic Specificity | Tmem130 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal anti-Tmem130 antibody |
Immunogen | The immunogen for anti-Tmem130 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVFLMYMTVRSAATQKDIVESPGATGLKCCCQVCCGSLFLDSPSEYLEIV |
Other Names | transmembrane protein 130 |
Gene, Accession # | Tmem130, Accession: NM_177735 |
Catalog # | TA329619 |
Price | |
Order / More Info | Tmem130 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |