| Edit |   |
|---|
| Antigenic Specificity | TMEM114 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine, porcine, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TMEM114 Antibody |
|---|
| Immunogen | The immunogen for Anti-TMEM114 Antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM114. Synthetic peptide located within the following region: GPGAQDLLGSINRSQPEPLSSHSGLWRTCRVQSPCTPLMNPFRLENVTVS |
|---|
| Other Names | transmembrane protein 114 |
|---|
| Gene, Accession # | TM114, Accession: NM_001146336 |
|---|
| Catalog # | TA332175 |
|---|
| Price | |
|---|
| Order / More Info | TMEM114 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|