| Edit |   |
|---|
| Antigenic Specificity | Tmem110 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat, bovine, dog, human, porcine |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Tmem110 Antibody |
|---|
| Immunogen | The immunogen for Anti-Tmem110 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIV |
|---|
| Other Names | transmembrane protein 110 |
|---|
| Gene, Accession # | Tmem110, Accession: NM_198774 |
|---|
| Catalog # | TA333344 |
|---|
| Price | |
|---|
| Order / More Info | Tmem110 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|