| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB, ICC/IF reported in scientific literature (PMID: 26217791). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPT1. This antibody reacts with human. The PPT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFY |
|---|
| Other Names | ceroid-palmitoyl-palmitoyl-protein thioesterase 1, CLN1EC 3.1.2.22, INCL, Palmitoyl-protein hydrolase 1, palmitoyl-protein thioesterase 1, PPT, PPT-1 |
|---|
| Gene, Accession # | PPT1, Gene ID: 5538 |
|---|
| Catalog # | NBP1-85563 |
|---|
| Price | |
|---|
| Order / More Info | PPT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26217791 |
|---|
| 产品资料 |
|
|