| Edit |   |
|---|
| Antigenic Specificity | clarin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The clarin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to clarin 1. This antibody reacts with human. The clarin 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CLRN1 (clarin 1) The peptide sequence was selected from the C terminal of CLRN1. Peptide sequence QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL. |
|---|
| Other Names | clarin 1, clarin-1, USH3, USH3AUsher syndrome type-3 protein, Usher syndrome 3A |
|---|
| Gene, Accession # | CLRN1, Gene ID: 7401, Accession: P58418, SwissProt: P58418 |
|---|
| Catalog # | NBP1-69142 |
|---|
| Price | |
|---|
| Order / More Info | clarin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|