| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ERGI3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ERGI3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERGI3. This antibody reacts with human. The ERGI3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ERGI3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVH |
|---|
| Other Names | C20orf47, CGI-54, chromosome 20 open reading frame 47, dJ477O4.2, endoplasmic reticulum-Golgi intermediate compartment protein 3, endoplasmic reticulum-localized protein ERp43, ERGIC and golgi 3, Erv46, NY-BR-84, PRO0989, SDBCAG84, serologically defined breast cancer antigen 84, Serologically defined breast cancer antigen NY-BR-84 |
|---|
| Gene, Accession # | ERGIC3, Gene ID: 51614 |
|---|
| Catalog # | NBP1-89882 |
|---|
| Price | |
|---|
| Order / More Info | ERGI3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|