| 产品详情 |
| Edit |   |
| Antigenic Specificity | eRF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The eRF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to eRF1. This antibody reacts with human. The eRF1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human eRF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEF |
| Other Names | D5S1995, ERF1eRF1, eukaryotic peptide chain release factor subunit 1, Eukaryotic release factor 1, eukaryotic translation termination factor 1, polypeptide chain release factor 1, Protein Cl1, RF1ERF, sup45 (yeast omnipotent suppressor 45) homolog-like 1, SUP45L1, TB3-1MGC111066 |
| Gene, Accession # | ETF1, Gene ID: 2107, Accession: P62495, SwissProt: P62495 |
| Catalog # | NBP2-38350 |
| Price | |
| Order / More Info | eRF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|