| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-28R alpha/IFN-lambda R1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-28R alpha/IFN-lambda R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-28R alpha/IFN-lambda R1. This antibody reacts with human. The IL-28R alpha/IFN-lambda R1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: alpha |
|---|
| Immunogen | Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. |
|---|
| Other Names | class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2 |
|---|
| Gene, Accession # | IFNLR1, Gene ID: 163702, Accession: Q5VTX8, SwissProt: Q5VTX8 |
|---|
| Catalog # | NBP1-69635 |
|---|
| Price | |
|---|
| Order / More Info | IL-28R alpha/IFN-lambda R1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|