| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LAR/PTPRF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Receptor-type tyrosine-protein phosphatase F(PTPRF) detection. Tested with WB, IHC-P in Human. No cross reactivity with other proteins. Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids. |
|---|
| Other Names | Receptor-type tyrosine-protein phosphatase F;3.1.3.48;Leukocyte common antigen related;LAR;PTPRF;LAR; |
|---|
| Gene, Accession # | PTPRF, UniProt: P10586 |
|---|
| Catalog # | PB9786 |
|---|
| Price | |
|---|
| Order / More Info | LAR/PTPRF Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|