| Edit |   |
|---|
| Antigenic Specificity | PIP3-E |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PIP3-E antibody. Specificity: PIP3-E antibody was raised against the C terminal of PIP3-E |
|---|
| Immunogen | PIP3-E antibody was raised using the C terminal of PIP3-E corresponding to a region with amino acids DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS |
|---|
| Other Names | PIP3-E; PIP3-E; PIP-E-3; KIAA0403; PIP-E 3; PIP3-E; IPCEF1; RP3-402L9.2; Phosphoinositide-Binding Protein Pip3-E, |
|---|
| Gene, Accession # | PIP3-E |
|---|
| Catalog # | MBS5301541 |
|---|
| Price | |
|---|
| Order / More Info | PIP3-E Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|