| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GAL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-GAL4 Antibody. Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids. |
|---|
| Other Names | galectin-4; Galectin-4; galectin-4; galectin 4; Antigen NY-CO-27; L-36 lactose-binding protein; L36LBP; Lactose-binding lectin 4, LGALS4; LGALS4; GAL4; L36LBP; Gal-4; L36LBP |
|---|
| Gene, Accession # | LGALS4, Gene ID: 3960, NCBI: NP_006140.1, UniProt: P56470 |
|---|
| Catalog # | MBS178452 |
|---|
| Price | |
|---|
| Order / More Info | GAL4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: LGALS4 lectin, galactoside-binding, soluble, 4 (galectin 4). 2. Barondes SH, Cooper DN, Gitt MA, Leffler H (Sep 1994). Galectins. Structure and function of a large family of animal lectins. J Biol Chem 269 (33): 20807-10. 3. Rechreche, H., Mallo, G. V., Montalto, G., Dagorn, J.-C., Iovanna, J. L. Cloning and expression of the mRNA of human galectin-4, an S-type lectin down-regulated in colorectal cancer. Europ. J. Biochem. 248: 225-230, 1997. |
|---|
| 产品资料 |
|
|