| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LCAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-LCAT Antibody. Specificity: No cross reactivity with other proteins |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR), different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids. |
|---|
| Other Names | phosphatidylcholine-sterol acyltransferase; Phosphatidylcholine-sterol acyltransferase; phosphatidylcholine-sterol acyltransferase; lecithin cholesterol acyltransferase; Lecithin-cholesterol acyltransferase; Phospholipid-cholesterol acyltransferase, Lcat; Lcat; AI046659; D8Wsu61e |
|---|
| Gene, Accession # | LCAT, Gene ID: 16816, NCBI: NP_032516.2, UniProt: P16301 |
|---|
| Catalog # | MBS177677 |
|---|
| Price | |
|---|
| Order / More Info | LCAT Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Azoulay, M., Henry, I., Tata, F., Weil, D., Grzeschik, K. H., Chaves, E., McIntyre, N., Williamson, R., Humphries, S. E., Junien, C. The structural gene for lecithin:cholesterol acyl transferase (LCAT) maps to 16q22. Ann. Hum. Genet. 51: 129-136, 1987. 2. Frohlich, J., McLeod, R., Hon, K. Lecithin:cholesterol acyl transferase (LCAT). Clin. Biochem. 15: 269-278, 1982. 3. Jonas, A. Lecithin cholesterol acyltransferase. Biochim. Biophys. Acta 1529: 245-256, 2000. |
|---|
| 产品资料 |
|
|