| Edit |   |
|---|
| Antigenic Specificity | Osteopontin |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), ELISA (EIA) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Osteopontin Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | osteopontin isoform OPN-b; Osteopontin; osteopontin; secreted phosphoprotein 1; Bone sialoprotein 1; Nephropontin; Secreted phosphoprotein 1; SPP-1; Urinary stone protein; Uropontin, SPP1; SPP1; OPN; BNSP; BSPI; ETA-1; BNSP; OPN; SPP-1 |
|---|
| Gene, Accession # | Gene ID: 6696, NCBI: NP_000573.1, UniProt: P10451 |
|---|
| Catalog # | MBS178082 |
|---|
| Price | |
|---|
| Order / More Info | Osteopontin Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: SPP1 secreted phosphoprotein 1. 2. Reinholt FP, Hultenby K, Oldberg A, Heinegard D (June 1990). Osteopontin--a possible anchor of osteoclasts to bone. Proc. Natl. Acad. Sci. U.S.A. 87 (12): 4473-5. 3. Wang KX, Denhardt DT (2008). Osteopontin: role in immune regulation and stress responses. Cytokine Growth Factor Rev. 19 (5-6): 333-45. |
|---|