| Edit |   |
|---|
| Antigenic Specificity | Osteomodulin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Osteomodulin antibody. Specificity: Osteomodulin antibody was raised against the middle region of OMD |
|---|
| Immunogen | Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD |
|---|
| Other Names | osteomodulin; Osteomodulin; osteomodulin; osteomodulin; Keratan sulfate proteoglycan osteomodulin; KSPG osteomodulin; Osteoadherin; OSAD, OMD; OMD; OSAD; SLRR2C; SLRR2C; KSPG osteomodulin; OSAD |
|---|
| Gene, Accession # | Gene ID: 4958, NCBI: NP_005005.1 |
|---|
| Catalog # | MBS839352 |
|---|
| Price | |
|---|
| Order / More Info | Osteomodulin Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|