| Edit |   |
|---|
| Antigenic Specificity | Complexin 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Complexin 2 antibody. Specificity: Complexin 2 antibody was raised against the N terminal of CPLX2 |
|---|
| Immunogen | Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA |
|---|
| Other Names | complexin 2, partial; Complexin-2; complexin-2; complexin 2; Complexin II; CPX II; Synaphin-1, CPLX2; CPLX2; CPX2; Hfb1; 921-L; CPX-2; CPX II |
|---|
| Gene, Accession # | Gene ID: 10814, NCBI: AAS93622.1 |
|---|
| Catalog # | MBS839157 |
|---|
| Price | |
|---|
| Order / More Info | Complexin 2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|