| Edit |   |
|---|
| Antigenic Specificity | ACDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACDC antibody. Specificity: ACDC antibody was raised against the N terminal Of Acdc |
|---|
| Immunogen | ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP |
|---|
| Other Names | ACDC; ACDC; Adipocyte C1q and Collagen Domain Containing Protein, |
|---|
| Gene, Accession # | ACDC |
|---|
| Catalog # | MBS838911 |
|---|
| Price | |
|---|
| Order / More Info | ACDC Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|