| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACCN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ACCN1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | acid-sensing ion channel 2 isoform MDEG1; Acid-sensing ion channel 2; acid-sensing ion channel 2; acid sensing ion channel subunit 2; Amiloride-sensitive brain sodium channel; Amiloride-sensitive cation channel 1, neuronal; Amiloride-sensitive cation channel neuronal 1; Brain sodium channel 1; BNC1; BNaC1; Mammalian degenerin homolog, ASIC2; ASIC2; ACCN; BNC1; MDEG; ACCN1; BNaC1; ASIC2a; hBNaC1; ACCN; ACCN1; BNAC1; MDEG; ASIC2; BNC1; BNaC1 |
|---|
| Gene, Accession # | ASIC2, Gene ID: 40, NCBI: NP_001085.2, UniProt: Q16515 |
|---|
| Catalog # | MBS178802 |
|---|
| Price | |
|---|
| Order / More Info | ACCN1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Vila-Carriles WH, Kovacs GG, Jovov B, Zhou ZH, Pahwa AK, Colby G, Esimai O, Gillespie GY, Mapstone TB, Markert JM, Fuller CM, Bubien JK, Benos DJ (Jul 2006). Surface expression of ASIC2 inhibits the amiloride-sensitive current and migration of glioma cells. The Journal of Biological Chemistry 281(28): 19220-32. 2. Waldmann R, Voilley N, Mattei MG, Lazdunski M (Oct 1996). The human degenerin MDEG, an amiloride-sensitive neuronal cation channel, is localized on chromosome 17q11.2-17q12 cl |
|---|
| 产品资料 |
|
|