Edit |   |
Antigenic Specificity | N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. |
Immunogen | NECAB3 antibody was raised using the middle region of NECAB3 corresponding to a region with amino acids ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV |
Other Names | Apba2bp|APBA2BP|NECAB3|EFCBP3|NIP1|STIP3|SYTIP2|XB51|dJ63M2.4|dJ63M2.5|2900010M17Rik|AI853434|Nip1 |
Gene, Accession # | Gene ID: 63941 |
Catalog # | ABIN632068 |
Price | |
Order / More Info | N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |