| Edit |   |
|---|
| Antigenic Specificity | Claudin Domain Containing 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Claudin Domain Containing 1 antibody. Specificity: Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1 |
|---|
| Immunogen | Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL |
|---|
| Other Names | Claudin domain containing 1; Claudin domain-containing protein 1; claudin domain-containing protein 1; claudin domain containing 1; Membrane protein GENX-3745, CLDND1; CLDND1; C3orf4; GENX-3745; C3orf4 |
|---|
| Gene, Accession # | Gene ID: 56650, NCBI: AAH95441.1 |
|---|
| Catalog # | MBS5302109 |
|---|
| Price | |
|---|
| Order / More Info | Claudin Domain Containing 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|