| Edit |   |
|---|
| Antigenic Specificity | Keratin 8 (KRT8) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle. |
|---|
| Immunogen | Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL |
|---|
| Other Names | ck8|cyk8|k2c8|card2|krt2-5|MGC69490|KRT8|DKFZp468F2127|CARD2|CK-8|CK8|CYK8|K2C8|K8|KO|KRT2-8|AA960620|AL022697|AU019895|Card2|EndoA|Krt-2.8|Krt2-8|CYKER|DreK8|cb186|krt2-8|sb:cb186|wu:fa20h05|wu:fa95h10|wu:fb96c06|zf-K8|zfk8|KERATIN8 |
|---|
| Gene, Accession # | Gene ID: 3856 |
|---|
| Catalog # | ABIN631865 |
|---|
| Price | |
|---|
| Order / More Info | Keratin 8 (KRT8) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|