| Edit |   |
|---|
| Antigenic Specificity | Keratin 75 (KRT75) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. |
|---|
| Immunogen | Cytokeratin 75 antibody was raised using the N terminal of KRT75 corresponding to a region with amino acids MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI |
|---|
| Other Names | KRT75|K6HF|KB18|PFB|4732468K03Rik|AA589387|K6hf|Krt2-6hf|Krtcap1|Kb18 |
|---|
| Gene, Accession # | Gene ID: 9119 |
|---|
| Catalog # | ABIN631611 |
|---|
| Price | |
|---|
| Order / More Info | Keratin 75 (KRT75) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|