| Edit |   |
|---|
| Antigenic Specificity | Keratin 13 (KRT13) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. |
|---|
| Immunogen | Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY |
|---|
| Other Names | krt13|CK13|K13|Ka13|Krt-1.13|Krt1-13|ck13|k13 |
|---|
| Gene, Accession # | Gene ID: 3860 |
|---|
| Catalog # | ABIN630838 |
|---|
| Price | |
|---|
| Order / More Info | Keratin 13 (KRT13) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|