Edit |   |
Antigenic Specificity | ZYG11A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZYG11A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZYG11A. This antibody reacts with human. The ZYG11A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZYG11A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HADLPVPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQLTGLRILSVFNVCFHTEDLANVSQLPR |
Other Names | zyg-11 homolog A (C. elegans), ZYG-11A early embryogenesis protein |
Gene, Accession # | ZYG11A, Gene ID: 440590 |
Catalog # | NBP1-93432 |
Price | |
Order / More Info | ZYG11A Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |