Edit |   |
Antigenic Specificity | PPP1R15B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PPP1R15B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R15B. This antibody reacts with human. The PPP1R15B Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to the C terminal of PPP1R15B. Immunizing peptide sequence SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL. |
Other Names | CREP, FLJ14744, protein phosphatase 1 regulatory subunit 15B, protein phosphatase 1, regulatory (inhibitor) subunit 15B |
Gene, Accession # | PPP1R15B, Gene ID: 84919, Accession: Q5SWA1, SwissProt: Q5SWA1 |
Catalog # | NBP1-74269-20ul |
Price | |
Order / More Info | PPP1R15B Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |