产品详情 |
Edit |   |
Antigenic Specificity | ZW10 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZW10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZW10. This antibody reacts with human. The ZW10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZW10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSE |
Other Names | E3 ubiquitin-protein ligase ZSWIM2, EC 6.3.2.-, MEKK1-related protein X, MEX, MGC33890, Zinc finger SWIM domain-containing protein 2, zinc finger, SWIM domain containing 2, zinc finger, SWIM-type containing 2, ZZZ2ZZ-type zinc finger-containing protein 2 |
Gene, Accession # | ZW10, Gene ID: 9183, Accession: O43264, SwissProt: O43264 |
Catalog # | NBP2-38644 |
Price | |
Order / More Info | ZW10 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|