| Edit |   |
|---|
| Antigenic Specificity | Endogenous Retrovirus Group W, Member 1 (ERVW-1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
|---|
| Immunogen | ERVWE1 antibody was raised using the N terminal of ERVWE1 corresponding to a region with amino acids TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR |
|---|
| Other Names | ENV|ENVW|ERVWE1|HERV-7q|HERV-W-ENV|HERV7Q|HERVW|HERVWENV |
|---|
| Gene, Accession # | Gene ID: 30816 |
|---|
| Catalog # | ABIN635520 |
|---|
| Price | |
|---|
| Order / More Info | Endogenous Retrovirus Group W, Member 1 (ERVW-1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|