Edit |   |
Antigenic Specificity | ZCCHC8 - C-terminal region |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | rat; human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ZCCHC8 Antibody - C-terminal region |
Immunogen | The immunogen for Anti-Zcchc8 antibody is: synthetic peptide directed towards the C-terminal region of Rat Zcchc8. Synthetic peptide located within the following region: FQPPLPPGTPPPLPQGTPPPLFTPPLPKGTPPLTPSDSPQPRPTASGVDE |
Other Names | zinc finger, CCHC domain containing 8 |
Gene, Accession # | ZCHC8, Accession: NM_017612 |
Catalog # | TA344986 |
Price | |
Order / More Info | ZCCHC8 - C-terminal region Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |