| Edit |   |
|---|
| Antigenic Specificity | Charged Multivesicular Body Protein 1B (CHMP1B) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression. |
|---|
| Immunogen | CHMP1 B antibody was raised using the N terminal of CHMP1 corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT |
|---|
| Other Names | C10orf2|C18-ORF2|C18orf2|CHMP1.5|Vps46-2|Vps46B|hVps46-2|2810405I11Rik|Chmp1b1|Chmp1.5|fb10c03|wu:fb10c03|zgc:56134 |
|---|
| Gene, Accession # | Gene ID: 57132 |
|---|
| Catalog # | ABIN632659 |
|---|
| Price | |
|---|
| Order / More Info | Charged Multivesicular Body Protein 1B (CHMP1B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|