Edit |   |
Antigenic Specificity | Arf4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | bovine, human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-Arf4 Antibody |
Immunogen | The immunogen for anti-Arf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD |
Other Names | ARF2, ADP-ribosylation factor 4 |
Gene, Accession # | Arf4, Accession: NM_001660 |
Catalog # | TA335123 |
Price | |
Order / More Info | Arf4 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |