| Edit |   |
| Antigenic Specificity | Arf4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-Arf4 Antibody |
| Immunogen | The immunogen for anti-Arf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD |
| Other Names | ARF2, ADP-ribosylation factor 4 |
| Gene, Accession # | Arf4, Accession: NM_001660 |
| Catalog # | TA335123 |
| Price | |
| Order / More Info | Arf4 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |