| Edit |   |
|---|
| Antigenic Specificity | N4BP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-N4BP3 Antibody |
|---|
| Immunogen | The immunogen for Anti-N4BP3 antibody is: synthetic peptide directed towards the N-terminal region of Human N4BP3. Synthetic peptide located within the following region: GQREFLSYLHLPKKDSKSTKNTKRAPRNEPADYATLYYREHSRAGDFSKT |
|---|
| Other Names | LZTS4, NEDD4 binding protein 3 |
|---|
| Gene, Accession # | N4BP3, Accession: NM_015111 |
|---|
| Catalog # | TA337456 |
|---|
| Price | |
|---|
| Order / More Info | N4BP3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|