产品详情 |
Edit |   |
Antigenic Specificity | NF-M |
Clone | 2688 |
Host Species | Mouse |
Reactive Species | human, mouse, rat |
Isotype | IgG1 |
Format | Protein A purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. It has been reported that the antibody gives weak staining when testing in IHC on frozen tissue sections. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The NF-M Antibody (2688) from Novus Biologicals is a mouse monoclonal antibody to NF-M. This antibody reacts with human, mouse, rat. The NF-M Antibody (2688) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NF-M antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH |
Other Names | NEF3neurofilament medium polypeptide, Neurofilament 3, neurofilament, medium polypeptide, neurofilament, medium polypeptide 150kDa, neurofilament-3 (150 kD medium), NF-M160 kDa neurofilament protein, NFMNeurofilament triplet M protein |
Gene, Accession # | NEFM, Gene ID: 4741, Accession: P07197 |
Catalog # | NBP2-46618 |
Price | |
Order / More Info | NF-M Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|