| Edit |   |
|---|
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state. |
|---|
| Immunogen | CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA |
|---|
| Other Names | CACNG6|cacng6|MGC122711|2310033H20Rik|AW050150 |
|---|
| Gene, Accession # | Gene ID: 59285 |
|---|
| Catalog # | ABIN633735 |
|---|
| Price | |
|---|
| Order / More Info | Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|