| Edit |   |
|---|
| Antigenic Specificity | Iron-Sulfur Cluster Assembly 2 Homolog (S. Cerevisiae) (ISCA2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly. |
|---|
| Immunogen | ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY |
|---|
| Other Names | HBLD1|ISA2|c14_5557|Hbld1|RGD1563216|0710001C05Rik|5730594E03Rik |
|---|
| Gene, Accession # | Gene ID: 122961,74316,500694 |
|---|
| Catalog # | ABIN631044 |
|---|
| Price | |
|---|
| Order / More Info | Iron-Sulfur Cluster Assembly 2 Homolog (S. Cerevisiae) (ISCA2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|