| Edit |   |
| Antigenic Specificity | Iron-Responsive Element Binding Protein 2 (IREB2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA. |
| Immunogen | IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK |
| Other Names | IREB2|im:7153062|DKFZp468N047|D9Ertd85e|Irp2|ACO3|IRP2|IRP2AD|IREBP2 |
| Gene, Accession # | Gene ID: 3658 |
| Catalog # | ABIN633564 |
| Price | |
| Order / More Info | Iron-Responsive Element Binding Protein 2 (IREB2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |