| Edit |   |
| Antigenic Specificity | ORAI1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 64%, rat 57%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ORAI1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA |
| Other Names | ORAI calcium release-activated calcium modulator 1, CRACM1, FLJ14466, TMEM142A |
| Gene, Accession # | Gene ID: None, UniProt: None, ENSG00000276045 |
| Catalog # | HPA061823 |
| Price | |
| Order / More Info | ORAI1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |