| Edit |   |
|---|
| Antigenic Specificity | serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. |
|---|
| Immunogen | SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM |
|---|
| Other Names | 1110036M19Rik|AI462524|AI646751|Maspin|PI-5|Spi7|ovalbumin|PI5|maspin|Pi5 |
|---|
| Gene, Accession # | Gene ID: 5268 |
|---|
| Catalog # | ABIN629846 |
|---|
| Price | |
|---|
| Order / More Info | serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|