Edit |   |
Antigenic Specificity | AADACL1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The AADACL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AADACL1. This antibody reacts with mouse. The AADACL1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the middle region of human Aadacl1The immunogen for this antibody is Aadacl1. Peptide sequence LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS. |
Other Names | AADACL1, EC 3.1.1.79, KIAA1363EC 3.1.1, NCEHArylacetamide deacetylase-like 1EC 3.1.1.-, neutral cholesterol ester hydrolase 1 |
Gene, Accession # | NCEH1, Gene ID: 57552, Accession: NP_848887 |
Catalog # | NBP1-79318 |
Price | |
Order / More Info | AADACL1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |