| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCG8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for ATP-binding cassette sub-family G member 8(ABCG8) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. ATP-binding cassette sub-family G member 8 is a protein that in humans is encoded by the ABCG8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids. |
|---|
| Other Names | ATP-binding cassette sub-family G member 8;Sterolin-2;ABCG8; |
|---|
| Gene, Accession # | ABCG8, UniProt: Q9H221 |
|---|
| Catalog # | A01482-1 |
|---|
| Price | |
|---|
| Order / More Info | ABCG8 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|