| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RD RNA Binding Protein (RDBP) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins, however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. |
|---|
| Immunogen | RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS |
|---|
| Other Names | CG5994|Dmel\\CG5994|NELF|NELF-E|Nelf-e|anon-66Da|cg5994|dNelf-E|D6S45|RD|RDBP|RDP|Rd|Rdbp|D17H6S45 |
|---|
| Gene, Accession # | Gene ID: 7936,27632 |
|---|
| Catalog # | ABIN633203 |
|---|
| Price | |
|---|
| Order / More Info | RD RNA Binding Protein (RDBP) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|