| Edit |   |
|---|
| Antigenic Specificity | ABCB10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 94%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ABCB10 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE |
|---|
| Other Names | ATP-binding cassette, sub-family B (MDR/TAP), member 10, EST20237, M-ABC2, MTABC2 |
|---|
| Gene, Accession # | Gene ID: 23456, UniProt: Q9NRK6, ENSG00000135776 |
|---|
| Catalog # | HPA055175 |
|---|
| Price | |
|---|
| Order / More Info | ABCB10 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|