| Edit |   |
| Antigenic Specificity | Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction. |
| Immunogen | CPSF1 antibody was raised using the middle region of CPSF1 corresponding to a region with amino acids GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE |
| Other Names | CG10110|CPSF|CPSF-160|CPSF160|Cpsf|Dmel\\CG10110|anon-WO0118547.217|cpsf|dCPSF-160|wu:fb24c01|CPSF1|DKFZp469K0832|HSU37012|P/cl.18|ATCPSF160|K17N15.21|K17N15_21|cleavage and polyadenylation specificity factor 160 |
| Gene, Accession # | Gene ID: 29894 |
| Catalog # | ABIN633437 |
| Price | |
| Order / More Info | Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |