| Edit |   |
|---|
| Antigenic Specificity | Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. |
|---|
| Immunogen | CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL |
|---|
| Other Names | CPSF3|si:dkey-81b15.1|wu:fc32f10|zgc:101655|CPSF-73|CPSF73 |
|---|
| Gene, Accession # | Gene ID: 51692 |
|---|
| Catalog # | ABIN629924 |
|---|
| Price | |
|---|
| Order / More Info | Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|