| Edit |   |
|---|
| Antigenic Specificity | N-Myristoyltransferase 1 (NMT1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1). |
|---|
| Immunogen | NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT |
|---|
| Other Names | nmt1|MGC53594|MGC145283|ARABIDOPSIS THALIANA MYRISTOYL-COA:PROTEIN N-MYRISTOYLTRANSFERASE|ATNMT1|MHM17.15|MHM17_15|N-MYRISTOYLTRANSFERASE 1|myristoyl-CoA:protein N-myristoyltransferase|NMT|AW536594|im:2601337|wu:fc15d01|wu:fc18a04|zgc:110714 |
|---|
| Gene, Accession # | Gene ID: 4836,18107,259274 |
|---|
| Catalog # | ABIN630887 |
|---|
| Price | |
|---|
| Order / More Info | N-Myristoyltransferase 1 (NMT1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|