| Edit |   |
|---|
| Antigenic Specificity | A Kinase (PRKA) Anchor Protein 10 (AKAP10) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA, therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction. |
|---|
| Immunogen | AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ |
|---|
| Other Names | MGC84612|AKAP10|fc10g11|wu:fc10g11|si:dkey-197m14.4|AKAP-10|D-AKAP-2|D-AKAP2|PRKA10|1500031L16Rik|B130049N18Rik|D-akap2|Akap10 |
|---|
| Gene, Accession # | Gene ID: 11216 |
|---|
| Catalog # | ABIN632020 |
|---|
| Price | |
|---|
| Order / More Info | A Kinase (PRKA) Anchor Protein 10 (AKAP10) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|