| Edit |   |
|---|
| Antigenic Specificity | WIPF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 78%, rat 77%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human WIPF3 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFESKFTFHSVEDFPPPDEYKPCQKIYPS |
|---|
| Other Names | WAS/WASL interacting protein family, member 3, CR16, FLJ36931 |
|---|
| Gene, Accession # | Gene ID: 644150, UniProt: A6NGB9, ENSG00000122574 |
|---|
| Catalog # | HPA041211 |
|---|
| Price | |
|---|
| Order / More Info | WIPF3 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|