Edit |   |
Antigenic Specificity | WIPF3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The WIPF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WIPF3. This antibody reacts with human. The WIPF3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human WIPF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS |
Other Names | WAS/WASL interacting protein family, member 3 |
Gene, Accession # | WIPF3, Gene ID: 644150 |
Catalog # | NBP1-84388 |
Price | |
Order / More Info | WIPF3 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |