| Edit |   |
|---|
| Antigenic Specificity | Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells. |
|---|
| Immunogen | DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG |
|---|
| Other Names | DLG7|dlg7|sb:cb647|zgc:92146|wu:fc96g08|wu:fe11c02|HURP|C77459|C86398|Dap-5|Dlg7|Hurp|mKIAA0008 |
|---|
| Gene, Accession # | Gene ID: 9787,218977 |
|---|
| Catalog # | ABIN630974 |
|---|
| Price | |
|---|
| Order / More Info | Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|