| Edit |   |
|---|
| Antigenic Specificity | Dynein, Light Chain, LC8-Type 2 (DYNLL2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, C. elegans, Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures. |
|---|
| Immunogen | DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY |
|---|
| Other Names | dynll2|wu:fd56c09|zgc:73406|dlc2|dncl1b|1700064A15Rik|6720463E02Rik|C87222|DLC8|DLC8b|Dlc2|DNCL1B|RSPH22 |
|---|
| Gene, Accession # | Gene ID: 140735,68097,140734 |
|---|
| Catalog # | ABIN630885 |
|---|
| Price | |
|---|
| Order / More Info | Dynein, Light Chain, LC8-Type 2 (DYNLL2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|