| 产品详情 |
| Edit |   |
| Antigenic Specificity | INT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The INT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to INT3. This antibody reacts with human. The INT3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human INT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP |
| Other Names | C1orf193, C1orf60, chromosome 1 open reading frame 60, DKFZp686E1950, DKFZp686O20115, DKFZp781I1253, FLJ21919, FLJ44849, INT3, integrator complex subunit 3, RP11-216N14.4, Sensor of single-strand DNA complex subunit A, sensor of ssDNA A, Sensor of ssDNA subunit A, SOSS complex subunit A, SOSS-A |
| Gene, Accession # | INTS3, Gene ID: 65123 |
| Catalog # | NBP2-57633 |
| Price | |
| Order / More Info | INT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|