| Edit |   |
| Antigenic Specificity | Proenkephalin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Proenkephalin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proenkephalin. This antibody reacts with human. The Proenkephalin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PENK(proenkephalin) The peptide sequence was selected from the middle region of PENK. Peptide sequence DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG. |
| Other Names | enkephalin A, preproenkephalin, proenkephalin, proenkephalin-A |
| Gene, Accession # | PENK, Gene ID: 5179, Accession: P01210, SwissProt: P01210 |
| Catalog # | NBP1-59326 |
| Price | |
| Order / More Info | Proenkephalin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |