| Edit |   |
|---|
| Antigenic Specificity | Proenkephalin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Proenkephalin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proenkephalin. This antibody reacts with human. The Proenkephalin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PENK(proenkephalin) The peptide sequence was selected from the middle region of PENK. Peptide sequence DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG. |
|---|
| Other Names | enkephalin A, preproenkephalin, proenkephalin, proenkephalin-A |
|---|
| Gene, Accession # | PENK, Gene ID: 5179, Accession: P01210, SwissProt: P01210 |
|---|
| Catalog # | NBP1-59326 |
|---|
| Price | |
|---|
| Order / More Info | Proenkephalin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|